PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof020131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 121aa    MW: 13313.1 Da    PI: 9.8363
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17268392PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.92e-1267111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT  E++++++a +++  + Wk+I +++g  +t  q++s+ qky
        Sof020131  67 RESWTNPEHDKFLEALQLFDRD-WKKIEAYVG-FKTVIQIRSHAQKY 111
                      789*****************77.*********.9************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.24E-1661117IPR009057Homeodomain-like
PROSITE profilePS5129412.86762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-665117IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-1865114IPR006447Myb domain, plants
SMARTSM007173.4E-966114IPR001005SANT/Myb domain
PfamPF002493.4E-1067111IPR001005SANT/Myb domain
CDDcd001671.44E-769112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MVSMSTTPHP LDPSVPAVAG GGKEEAREAA AAAAAAAPTA VPVPPVGNDD DEGPRRVRKP  60
YTITKSRESW TNPEHDKFLE ALQLFDRDWK KIEAYVGFKT VIQIRSHAQK YFLKVQKNGT  120
R
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.65440.0callus| inflorescence| leaf| root| seed| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008659381.13e-60PREDICTED: protein REVEILLE 6-like
SwissprotQ8H0W33e-39RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A0C6WCQ01e-64A0A0C6WCQ0_9POAL; ScMYB45 protein
STRINGGRMZM2G135052_P018e-60(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-38MYB_related family protein